Storage and Stability:May be stored at 4°C for short-term only.
For long-term storage, store at -20°C.
Aliquots are stable for at least 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：50ug
Host：goat
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a liquid in PBS, 0.09% sodium azide.
Specificity：Peptide sequence is <50% identical to other sequences in geneban. Recognizes human IL-21 receptor. Not tested for cross reactivity to mouse IL21 receptor.
Isotype：IgG
Calc Applications Abbrev：E IHC
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor.
