IL-21 is a 155 amino acid pro-cytokine, reduced to 133 anino acids in the secreted mature form.
IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells.
Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus (UniProt: Q9HBE4).
IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells.
IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway.
Applications:Suitable for use in ELISA, Immunocytochemistry and Immunohistochemistry.
Other applications not tested.
Recommended Dilutions:ELISA: 1:50,000Immunocytochemistry: using human tonsilImmunohistochemistry: 1:250Optimal dilution determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：goat
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography
Form：Supplied as a liquid in PBS, 1mg/ml BSA, 0.09% sodium azide.
Specificity：Recognizes human IL-21
Isotype：IgG
Calc Applications Abbrev：E IC IHC
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa40-68, C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE, at the N-terminal region of human IL-21
