STATs (signal transducers and activators of transcription) are a family of cytoplasmic latent transcription factors that are activated in response to a large number of extracellular signals including cytokines, interferons, and growth factors.
All seven STATs (STAT1, STAT2, STAT3, STAT4, STAT5a, STAT5b, and STAT6), STAT1, STAT3, STAT5a, and STAT5b have a wide activation profile (3,4).
STAT1 is activated by many different ligands including the IFN family (IFN-alpha, IFN-beta, IFN-gama and IL-10), the gp130 family (IL-6, IL-11, LIF, CNTF, and G-CSF), and receptor tyrosine kinases (EGF, PDGF, CSF01) (3).
STAT1 has two forms, the 91kD STAT1alpha and the 84kD STAT1beta, which are encoded by the same gene with splicing vari-ant (1).
After tyrosine phosphorylation by Janus tyrosine kinase (JAK), STATs enter the nucleus to regulate transcription of many different genes.
Applications:Western Blot (ECL): 0.5ug/mL Immunoprecipitation: 2-4ug/sample Optimal dilutions to be determined by researcher.
Positive Controls:HeLa Cell Lysate Rat Brain Tissue Extract F
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Highly Purified
Purity：DEAE purified.
Form：Supplied as a liquid in PBS, pH 7.2, containing 0.02% sodium azide.
Specificity：Detects a ~97kD protein, corresponding to the apparent molecular mass of STAT1alpha on SDS-PAGE immunoblots, in human, mouse, rat and bovine cell lysates and tissue extracts. This antibody does not detect the 84kD STAT1beta.
Isotype：IgG
Calc Applications Abbrev：IP WB
Calc Crossreactivity：Bo Hu Mo Rt
Immunogen：A 39 residue synthetic peptide VHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV based on the human STAT1alpha (residues 712-750) was synthesized and the peptide cou-pled to KLH. The sequence differs from that of mouse by four amino acids. The carboxy terminal 38 amino acids are required to trigger transcription
