Applications: Suitable for use in ELISA, Western Blot, Flow Cytometry and Immunohistochemistry.
Other applications have not been tested.
Recommended Dilution:ELISA: 1:37,500Immunohistochemistry (paraffin): 1:250Western Blot: 1:50Flow Cytometry: 1:200Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：200ug
Host：goat
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography
Form：Supplied as a liquid in PBS, pH 7.2, 1mg/ml BSA, 0.09% sodium azide.
Specificity：Recognizes human TLR5. Peptide sequence is < 50% identical to other human TLR receptors in this region. Not tested for crossreactivity to mouse TLR5.
Isotype：IgG
Calc Applications Abbrev：E FC IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa151-181, DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ, from human TLR5.
