Applications:Suitable for use in Western Blot and Immunoprecipitation.
Other applications have not been tested.
Recommended Dilution:Western Blot: 0.1–2ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells.
3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1ug/ml).
Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemilum-inescence detection system.
Immunoprecipitation Kinase Assay: 4ug immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50ng/ml) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.
Optimal dilutions to be determined by the researcher.
Positive Antigen Control for Western Blot:3T3/A31 cell lysate.
Use 20ug per lane for minigels.
Storage and Stability:May be stored at 4°C for short-term only.
For long-term storage and to avoid repeated freezing and thawing, aliquot and add glycerol (40-50%).
Freeze at -20°C.
Aliquots are stable for at least 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：rat
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a solution in 0.2M Tris-glycine, pH 7.4, 0.15M NaCl, 0.05% sodium azide, 0.1mM EDTA.
Specificity：Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species Crossreactivity: Human, mouse, chicken and starfish. Species Sequence Homology: Chinese hamster: 35/35; mouse: 34/35; human: 32/35
Isotype：IgG
Calc Applications Abbrev：IP WB
Calc Crossreactivity：Ch Hu Mo Rt
Immunogen：Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled)
