83-6084-07　TNFRSF10C (CD263, DCR1, LIT, MGC149501, MGC149502, TRAILR3,TRID, TNF related TRAIL receptor, TNF related apoptosis-inducing ligand receptor 3, TRAIL receptor 3, antagonist decoy receptor for TRAIL/Apo-2L, decoy receptor 1, decoy without an intracellular domain, lymphocyte inhibitor of TRAIL, tumor necrosis factor receptor sup) 50ug　588781

特徴

• The protein encoded by this gene is a member of the TNF-receptor superfamily.
• This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain.
• This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis.
• This gene was found to be a p53-regulated DNA damage-inducible gene.
• The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIVLIVLLIVFV
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.