83-6083-33　S100A2 (CAN19, MGC111539, S100L, S100 calcium-binding protein A2) 50ug　588702

特徴

• The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs.
• S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation.
• S100 genes include at least 13 members which are located as a cluster on chromosome 1q21.
• This protein may have a tumor suppressor function.
• Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.