83-6082-22　OLR1 (CLEC8A, LOX1, SCARE1, lectin-type oxidized LDL receptor 1 ,oxidised low density lipoprotein (lectin-like) receptor 1, scavenger receptor class E, member 1) 50ug　588591

特徴

• This gene encodes a receptor protein which belongs to the C-type lectin superfamily.
• This gene is regulated through the cyclic AMP signaling pathway.
• The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein.
• This protein may be involved in the regulation of Fas-induced apoptosis.
• This protein may play a role as a scavenger receptor.
• Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease.
• Alternative transcript variants have been described but their full-length sequence has not been determined.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.