83-6080-96　IL9 (HP40, IL-9, P40, T-cell growth factor p40, homolog of mouse T cell and mast cell growth factor 40, p40 T-cell and mast cell growth factor, p40 cytokine) 50ug　588466

特徴

• The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells.
• This cytokine stimulates cell proliferation and prevents apoptosis.
• It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.
• The gene encoding this cytokine has been identified as a candidate gene for asthma.
• Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.