83-6080-77　HOM-TES-103 (Intermediate Filament Family Orphan 1, DKFZp586I2223, FLJ20703, HOM-TES-103, IFFO, MGC117359) 50ug　588447

特徴

• his gene is a member of the intermediate filament family.
• Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope.
• The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain.
• Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified.
• Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed.
• [provided by RefSeq}
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.