83-6079-33　CDC25C (CDC25, cell division cycle 25C, cell division cycle 25C protein, dual specificity phosphatase CDC25C, m-phase inducer phosphatase 3, mitosis inducer CDC25, phosphotyrosine phosphatase) 50ug　588297

特徴

• This gene is highly conserved during evolution and it plays a key role in the regulation of cell division.
• The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family.
• It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis.
• It is also thought to suppress p53-induced growth arrest.
• Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.