83-6079-32　CD99 (MIC2, MIC2X, MIC2Y, CD99 antigen,E2 antigen, MIC2 (monoclonal antibody 12E7), T-cell surface glycoprotein E2, antigen identified by monoclonal 12E7, Y homolog, antigen identified by monoclonal antibodies 12E7, F21 and O13, surface antigen MIC2) 50ug　588296

特徴

• The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway.
• In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma.
• Cyclophilin A binds to CD99 and may act as a signaling regulator of CD99.
• This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation.
• Two transcript variants encoding different isoforms have been found for this gene.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.