83-6079-26　CCL24 (Ckb-6, MPIF-2, MPIF2, SCYA24, CK-beta-6, eotaxin-2, myeloid progenitor inhibitory factor 2, small inducible cytokine A24, small inducible cytokine subfamily A (Cys-Cys), member 24) 50ug　588285

特徴

• This gene belongs to the subfamily of small cytokine CC genes.
• Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes.
• The CC cytokines are proteins characterized by two adjacent cysteines.
• The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes.
• The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.