83-6070-95　VCX3A (variable charge, X-Linked 3A, MGC118976, MGC125730, MGC125796, VCX-8r, VCX-A, VCX3, VCX8R, VCXA) 50ug　253369

特徴

• This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells.
• The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11.
• The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members.
• The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes.
• VCX/Y genes encode small and highly charged proteins of unknown function.
• The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins.
• This gene contains 8 repeats of the 30-bp unit.
• [provided by RefSeq
• Applications:Suitable for use in Immunofluorescence, Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSM
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.