83-6068-59　TNFSF15 (Tumor Necrosis Factor (Ligand) Superfamily, Member 15, MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A) 50ul　252846

特徴

• The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family.
• This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells.
• The expression of this protein is inducible by TNF and IL-1 alpha.
• This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6.
• It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells.
• This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor.
• An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.