83-6068-57　TNFSF12 (Tumor Necrosis Factor (Ligand) Superfamily, Member 12, APO3L, DR3LG, MGC129581, MGC20669, TWEAK) 50ul　252840

特徴

• The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family.
• This protein is a ligand for the FN14/TWEAKR receptor.
• This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution.
• This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner.
• This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis.
• Some transcripts that skip the last exon of this gene and continue with the second exon of the neighboring TNFSF13 gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
• [provided by RefSeq.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.