83-6067-33　TCEB2 (Transcription Elongation Factor B (SIII), Polypeptide 2 (18kD, elongin B), ELOB, SIII) 50ug　252464

特徴

• This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex.
• The SIII complex is composed of elongins A/A2, B and C.
• It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units.
• Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits.
• Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C.
• The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.
• Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Pseudogenes have been identified on chromosomes 11 and 13.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.