83-6066-91　TAF12 (TAF12 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 20kD, TAF2J, TAFII20) 50ul　252348

特徴

• Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins.
• These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site.
• Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors.
• Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex.
• Among the latter are the TAF proteins.
• Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases.
• TAF12 interacts directly with TBP as well as with TAF2I.
• Two transcript variants encoding the same protein have been found for this gene.
• [provided by RefSeq
• Applications:Suitable for use in Immunofluorescence, Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.