83-6064-82　SLURP1 (Secreted LY6/PLAUR Domain Containing 1, ANUP, ARS, ArsB, LY6LS, MDM) 50ul　251769

特徴

• The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence.
• It is thought that this secreted protein contains antitumor activity.
• Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder.
• This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.