83-6063-03　S100A7 (S100 Calcium Binding Protein A7, PSOR1, S100A7c) 50ul　251386

特徴

• The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs.
• S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation.
• S100 genes include at least 13 members which are located as a cluster on chromosome 1q21.
• This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus.
• This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility.
• The exact function of this protein is not known.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot, Immunohistochemistry.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.