83-6061-67　RGS13 (Regulator of G-Protein Signaling 13, MGC17173) 50ug　251088

特徴

• The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family.
• RGS family members share similarity with S.
• cerevisiae SST2 and C.
• elegans egl-10 proteins, which contain a characteristic conserved RGS domain.
• RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling.
• RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation.
• The biological function of this gene, however, is unknown.
• Two transcript variants encoding the same isoform exist.
• [provided by RefSeq
• Applications:Suitable for use in Immunofluorescence, Western Blot, Immunohistochemistry.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.