83-6053-55　NDUFA5 (NADH Dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kD, B13, CI-13KD-B, DKFZp781K1356, FLJ12147, NUFM, UQOR13) 50ul　249196

特徴

• The human NDUFA5 gene codes for the B13 subunit of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone.
• The high degree of conservation of NDUFA5 extending to plants and fungi indicates its functional significance in the enzyme complex.
• The protein localizes to the inner mitochondrial membrane as part of the 7 component-containing, water soluble "iron-sulfur protein" (IP) fraction of complex I, although its specific role is unknown.
• It is assumed to undergo post-translational removal of the initiator methionine and N-acetylation of the next amino acid.
• The predicted secondary structure is primarily alpha helix, but the carboxy-terminal half of the protein has high potential to adopt a coiled-coil form.
• The amino-terminal part contains a putative beta sheet rich in hydrophobic amino acids that may serve as mitochondrial import signal.
• Related pseudogenes have also been identified on four other chromosomes.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.