83-6052-63　MTCP1 (mature T-Cell Proliferation 1, C6.1B, P13MTCP1) 50ul　248994

特徴

• This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations.
• This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins.
• This gene represents the upstream 13 kDa protein that is a member of the TCL1 family.
• This protein may be involved in leukemogenesis.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.