83-6052-24　MRPS18B (Mitochondrial Ribosomal Protein S18B, C6orf14, DKFZp564H0223, HSPC183, HumanS18a, MRP-S18-2, MRPS18-2, PTD017, S18amt) 50ug　248909

特徴

• Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.
• Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.
• They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed.
• Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.
• Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology.
• This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family.
• The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins.
• The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins.
• Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.