83-6044-56　HMGA1 (High Mobility Group AT-hook 1, HMG-R, HMGA1A, HMGIY, MGC12816, MGC4242, MGC4854) 50ug　247136

特徴

• This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells.
• The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA.
• It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins.
• The encoded protein is frequently acetylated and is found in the nucleus.
• At least seven transcript variants encoding two different isoforms have been found for this gene.
• [provided by RefSeq
• Applications:Suitable for use in Immunofluorescence, Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.