83-6044-50　HLA-DRB3 (Major Histocompatibility Complex, Class II, DR beta 3, HLA-DR3B, MGC117330) 50ul　247123

特徴

• HLA-DRB3 belongs to the HLA class II beta chain paralogues.
• This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane.
• It plays a central role in the immune system by presenting peptides derived from extracellular proteins.
• Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages).
• The beta chain is approximately 26-28 kDa and its gene contains 6 exons.
• Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.
• Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities.
• Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation.
• DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5.
• The presence of DRB3 is linked with allelic variants of DRB1, otherwise it is omitted.
• There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9.
• [provided by RefSeq
• Applications:Suitable for use in Flow Cytometry, Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.