83-6043-68　GYPC (Glycophorin C (Gerbich Blood Group), CD236, CD236R, GE, GPC, GYPD, MGC117309, MGC126191, MGC126192) 50ul　246881

特徴

• Glycophorin C (GYPC) is an integral membrane glycoprotein.
• It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells.
• A number of glycophorin C mutations have been described.
• The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively.
• The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene.
• The glycophorin C protein has very little homology with glycophorins A and B.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.