This intronless gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.
The specific function of this gene has not yet been determined; however, it may play a role in tumor formation.
[provided by RefSeq
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEEEEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNMouse polyclonal antibody raised against a full-length human FOXD1 protein.AESLLLRGAGAAGGAGDPMouse polyclonal antibody raised against a full-length human FOXD1 protein.AALFPPAPPPPPHAYGYGPYGCGYGLQLPPYAPPSALFMouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.AAFHPHSPPPPPPPHGMouse polyclonal antibody raised against a full-length human FOXD1 protein.ELARTAFGYRPHPLGAALPGPLPASAAKAGGPGASALARSPFSIESIIGGSLGPMouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.AAQMouse polyclonal antibody raised against a full-length human FOXD1 protein.AAQASPSPSPVAAPPAPGSSGGGCAAQAAVGPMouse polyclonal antibody raised against a full-length human FOXD1 protein.LTRSLVMouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.ASSVSSSAALGTLHQGTALSSVENFTARISNC
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Purified
Purity：Purified
Form：Supplied as a liquid in PBS, pH 7.4.
Specificity：Recognizes human FOXD1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：FOXD1 (AAI60026.1, 1aa-465aa) full-length human protein.
