83-6038-80　EIF4EBP2 (Eukaryotic Translation Initiation Factor 4E Binding Protein 2, 4EBP2, PHASII) 50ul　245659

特徴

• This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family.
• The gene products of this family bind eIF4E and inhibit translation initiation.
• However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E.
• Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.