83-6033-41　CDK4 (Cyclin-Dependent Kinase 4, CMM3, MGC14458, PSK-J3) 50ul　244516

特徴

• The protein encoded by this gene is a member of the Ser/Thr protein kinase family.
• This protein is highly similar to the gene products of S.
• cerevisiae cdc28 and S.
• pombe cdc2.
• It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression.
• The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a).
• This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb).
• Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers.
• Multiple polyadenylation sites of this gene have been reported.
• [provided by RefSeq.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.