83-6033-13　CD81 (CD81 Molecule, S5.7, TAPA1, TSPAN28) 50ug　244424

特徴

• The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family.
• Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains.
• The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
• This encoded protein is a cell surface glycoprotein that is known to complex with integrins.
• This protein appears to promote muscle cell fusion and support myotube maintenance.
• Also it may be involved in signal transduction.
• This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.