83-6032-64　CCL21 (Chemokine (C-C Motif) Ligand 21, 6Ckine, CKb9, ECL, MGC34555, SCYA21, SLC, TCA4) 50ul　244313

特徴

• This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9.
• Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes.
• The CC cytokines are proteins characterized by two adjacent cysteines.
• Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis.
• This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils.
• The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs.
• It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19).
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.