This gene encodes a major constituent of the human complement subcomponent C1q.
C1q associates with C1r and C1s in order to yield the first component of the serum complement system.
A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis.
C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains.
Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region.
The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1.
This gene encodes the C-chain polypeptide of human complement subcomponent C1q.
Alternatively spliced transcript variants that encode the same protein have been found for this gene.
[provided by RefSeq
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
抗体種類:Pab
宿主:mouse
Source Antibody:human
Grade:Purified
Purity:Purified
Form:Supplied as a liquid in PBS, pH 7.4.
Specificity:Recognizes human C1QC.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:C1QC (NP_758957.2, 1aa-245aa) full-length human protein.