Versican is a large multi-domain chondroitin sulfate proteoglycan.
It is secreted by fibroblasts and other types of cells.
It has a N-terminal hyaluronic acid (HA) binding domain.
This domain has homology with the G1 and G2 domains of aggrecan (G1 is the hyaluronic acid binding region), to cartilage link protein which stabilizes the binding of aggrecan to hyaluronic acid, and, to the hyaluronate receptor CD44.
In addition, Versican also has a lectin-like domain, a C-terminal compliment repeat, and two EGF-like repeats, all of which can be found in aggrecan.
Versican has an apparent molecular mass of ~1000kD, of which the core contributes 400kD from the 2409aa, and the 12-15 covalently attached chondroitin sulfate chains make up the rest.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKRKCLIPF
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human VCAN.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human VCAN, aa1-354 (AAH50524.1).
