83-6018-40 SLC25A24 (Calcium-binding Mitochondrial Carrier Protein SCaMC-1, Mitochondrial ATP-Mg/Pi Carrier Protein 1, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 1, Small Calcium-binding Mitochondrial Carrier Protein 1, Solute Carrier Family 25 Member 24, APC1, MCSC1, SCAMC1) 50ug 133439
83-6018-40 SLC25A24 (Calcium-binding Mitochondrial Carrier Protein SCaMC-1, Mitochondrial ATP-Mg/Pi Carrier Protein 1, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 1, Small Calcium-binding Mitochondrial Carrier Protein 1, Solute Carrier Family 25 Member 24, APC1, MCSC1, SCAMC1) 50ug 133439
SLC25A24 (Solute carrier family 25 member 24) is a calcium-dependent mitochondrial solute carrier.
It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
抗体種類:Pab
宿主:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human SLC25A24.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:Full length human SLC25A24, aa1-477 (AAH14519).