83-6017-96　SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) 50ug　133281

特徴

• Inhibitor of the SLAM self-association.
• Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region.
• Mediates interaction between FYN and SLAMF1.
• May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.