83-6017-46　SECTM1 (Secreted and Transmembrane Protein 1, Protein K-12, K12) 50ug　133091

特徴

• SECTM1 (secreted and transmembrane 1), also called K12, is either found as an ~27kD intracellular type I transmembrane protein that shows a perinuclear, Golgi-like staining pattern, or as a 20kD soluble, secreted form.
• SECTM1 protein expression is detected in some myeloid cells, such as stimulated monocytes, immature monocyte-derived dendritic cells, and granulocytes.
• In the thymus, it is also expressed by epithelia and fibroblasts.
• Stimulation with IFNg is often necessary to detect SECTM1 expression, and it is thought to be an interferon earlyresponse gene.
• Human SECTM1 cDNA encodes 248aa, including a 28aa signal sequence, a 117aa extracellular domain (ECD) with one potential N-linked glycosylation site, a 21aa transmembrane sequence, and an 82aa cytoplasmic sequence.
• The ECD shows some similarity to Ig domains.
• The human SECTM1 ECD shares limited (~45-51%) aa sequence identity with mouse SECTM1 (a or b) and rat SECTM1 ECD.
• SECTM1 from human and mouse each show species specific binding of CD7 and co-stimulate CD4+ and CD8+ T cells through CD7, either alone or through synergy with CD28.
• Immobilized recombinant human SECTM1/Fc also enhances human NK cell expression of activation markers such as CD25, CD69 and CD54.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP*
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.