S100 calcium binding protein A4 (S100A4) is a member of the S100 family of calcium-binding proteins that contain two Ca(2+)-binding sites including a canonical EF-hand motif.
S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.
S100A4 interacts with cytoskeletal proteins and enhances metastasis of several types of cancer cells.
It is secreted by unknown mechanisms, thus, paracrinely stimulating a variety of cellular responses, including angiogenesis and neuronal growth.
S100A4 has been shown to be a prognostic marker in a number of human cancers, including esophageal-squamous cancers, non-small lung cancers, primary gastric cancers, malignant melanomas, prostate cancers, bladder cancers, and pancreatic carcinomas.
The universality of S100A4 expression in a variety of cancers illustrates the potential use of S100A4 as a marker for tumor metastasis and disease progression.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human S100A4.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human S100A4, aa1-101 (NP_002952.1).
