RUNX3, also called CBFA3, AML-2 or PEBP2-aC, is a member of the Runt domain family of nuclear transcriptional regulators.
All of the RUNX proteins form dimers with CBF-b.
The runt domain (aa54-186) is required for DNA binding, while a Pro/Ser/Thr-rich region (aa191-415) transcriptionally activates target genes.
Isoform 2 has an alternate 19aa sequence in place of the N-terminal 5aa of isoform 1.
The 415aa human RUNX3 shows 91% aa identity with mouse or rat RUNX3.
RUNX3 is necessary for growth control of gastric epithelium, neurogenesis of dorsal root ganglia, and T cell differentiation.
RUNX3 expression is frequently mutated in tumors and appears to be silenced by methylation.
Applications:Suitable for use in Immunofluorescence, Immunohistochemistry and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlImmunohistochemistry (Formalin fixed paraffin embedded): 3ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human RUNX3.
Isotype：IgG
Calc Applications Abbrev：IF IHC WB
Calc Crossreactivity：Hu
Immunogen：Full length human RUNX3, aa1-429 (AAH13362.1).
