83-6016-88 RTN3 (Reticulon-3, Neuroendocrine-specific Protein-like 2, NSP-like Protein 2, Neuroendocrine-specific Protein-like II, NSP-like Protein II, NSPLII, ASYIP, NSPL2) 50ug 132879
83-6016-88 RTN3 (Reticulon-3, Neuroendocrine-specific Protein-like 2, NSP-like Protein 2, Neuroendocrine-specific Protein-like II, NSP-like Protein II, NSPLII, ASYIP, NSPL2) 50ug 132879
May be involved in membrane trafficking in the early secretory pathway.
Inhibits BACE1 activity and amyloid precursor protein processing.
May induce caspase-8 cascade and apoptosis.
May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress.
In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
抗体種類:Pab
宿主:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human RTN3.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full-length human RTN3, aa1-236 (NP_006045.1).