Recoverin belongs to a high-affinity calcium-binding family that includes neuronal calcium sensor-1, visinin-like proteins (VILIPs), guanylate cyclase-activating proteins (GCAPs), and Kv-channel interacting proteins (KchIPs).
Features common to this family include four calcium-binding EF-hand domains, and an N-terminal myristoylation sequence.
This family of proteins has been implicated in a broad range of cellular signaling functions, including phototransduction and neurotransmitter release, lipid metabolism, gene expression, and ion channel regulation.
Myristoylation, the post-translational addition of a fatty acid tail, has been shown to have functional significance for other calcium-binding protein family members.
Recoverin is subject to the posttranslational modification of myristoylation.
Binding of calcium to recoverin elicits a change in conformation that exposes the buried hydrophobic myristoyl moiety to interaction with cell membranes and other cellular proteins.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human RCVRN.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human RCVRN, aa1-200 (NP_002894.1).
