RARRES3 also called Tig3 or RIG1 is an 18kD, 164aa cytoplasmic protein within the LRAT family of growth inhibitory proteins, which are class II tumor-suppressors.
RARRES3 is expressed in a variety of cells including epidermal keratinocytes, and may be downregulated in tumor cells and cell lines.
It shows phospholipase activity and interaction with type I transglutaminase.
A C-terminal hydrophobic region allows perinuclear localization.
RARRES3 is not structurally related to other RARRES genes.
A canine ortholog shares 72% aa identity within the region used as an immunogen; orthologs are unlikely in rodents.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
抗体種類:Pab
宿主:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human RARRES3.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:Full length human RARRES3, aa1-164 (AAH09678.1).