83-6013-79 PRKRIR (52kD Repressor of the Inhibitor of the Protein Kinase, p52rIPK, 58kD Interferon-induced Protein Kinase-interacting Protein, p58IPK-interacting Protein, Death-associated Protein 4, THAP Domain-containing Protein 0, DAP4, P52RIPK, THAP0, MGC102750) 50ug 131823
83-6013-79 PRKRIR (52kD Repressor of the Inhibitor of the Protein Kinase, p52rIPK, 58kD Interferon-induced Protein Kinase-interacting Protein, p58IPK-interacting Protein, Death-associated Protein 4, THAP Domain-containing Protein 0, DAP4, P52RIPK, THAP0, MGC102750) 50ug 131823
Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR).
May block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human PRKRIR.
Isotype：IgG
Calc Applications Abbrev：IF WB
Calc Crossreactivity：Hu
Immunogen：Full length human PRKRIR, aa1-150 (AAH21992.1).
