83-6009-50　NDUFA8 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 8, Complex I-19kD, CI-19kD, Complex I-PGIV, CI-PGIV, NADH-ubiquinone Oxidoreductase 19kD Subunit, MGC793) 50ug　130214

特徴

• NDUFA8 belongs to the complex I 19kD subunit family.
• Mammalian complex I is composed of 45 different subunits.
• This protein has NADH dehydrogenase activity and oxidoreductase activity.
• It plays an important role in transfering electrons from NADH to the respiratory chain.
• The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.