83-6009-49　NDUFA3 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 3, Complex I-B9, CI-B9, NADH-ubiquinone Oxidoreductase B9 Subunit) 50ug　130211

特徴

• Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.
• Complex I functions in the transfer of electrons from NADH to the respiratory chain.
• The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.