83-6009-48　NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13, Cell Death Regulatory Protein GRIM-19, Complex I-B16.6, CI-B16.6, Gene Associated with Retinoic and Interferon-induced Mortality 19 Protein, GRIM-19, Gene Associated with Retinoic and IFN-induced Mortality 19 Protein, NADH-ubiquinone Oxidoreductase B16.6 Subunit, GRIM19, CDA016, CGI-39) 50ug　130207

特徴

• Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.
• Complex I functions in the transfer of electrons from NADH to the respiratory chain.
• The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death.
• This apoptotic activity is inhibited by interaction with viral IRF1.
• Prevents the transactivation of STAT3 target genes.
• May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes.
• Applications:Suitable for use in Immunofluorescence, Western Blot and Immunohistochemistry.
• Other applications not tested.
• Recommended Dilution:Immunofluorescence: 10ug/mlImmunohistochemistry (Formalin fixed paraffin embedded): 3ug/mlOptimal dilutions to be determined by the researcher.
• AA Sequence:MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.