83-6009-22　NACAL (NACA2, Nascent Polypeptide-associated Complex Subunit alpha-2, Alpha-NAC-like, Hom s 2.01, Nascent Polypeptide-associated Complex Subunit alpha-like, NAC-alpha-like) 50ug　130117

特徴

• Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER).
• Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER.
• Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites).
• Applications:Suitable for use in Immunofluorescence and Western Blot.
• Other applications not tested.
• Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEIDEEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.