Musashi 1, a neural RNA-binding protein, plays an important role in regulating cell differentiation in precursor cells.
Musashi 1 (Msi-1) has been shown to increase the accumulation of tau isoforms in intracellular inclusions in dementia and Parkinson's.
The presence of Msi-1 in a significant percentage of neurons containing cytoplasmic inclusions in 2 other neurodegenerative diseases Alzheimer's disease and Pick disease suggests that it may play a role in the pathogenesis of these neurodegenerative disorders.
Musashi 1 has also been detected in human tumor tissues such as gliomas and melanomas, suggesting its involvement in cancer development.
Msi-1 also appears to play be an vital role in the development of several types of carcinoma such as human hepatoma, and may be a useful molecular marker for tumor detection.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human MSI1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human MSI1, aa1-362 (NP_002433.1).
