83-6008-69 MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8, Four-span Transmembrane Protein 4, Membrane-spanning 4-domains Subfamily A Member 8B, 4SPAN4, MS4A8B) 50ug 129914
83-6008-69 MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8, Four-span Transmembrane Protein 4, Membrane-spanning 4-domains Subfamily A Member 8B, 4SPAN4, MS4A8B) 50ug 129914
This gene encodes a member of the membrane-spanning 4A gene family.
Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.
The gene encoding this protein is localized to 11q12.3, among a cluster of family members.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human MS4A8B.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human MS4A8B, aa1-251 (AAH22895).
