83-6006-93　MAPK15 (ERK7, ERK8, Mitogen-activated Protein Kinase 15, MAP Kinase 15, MAPK 15, Extracellular Signal-regulated Kinase 7, ERK-7, Extracellular Signal-regulated Kinase 8, ERK-8) 50ug　129402

特徴

• The ERKs are a subfamily of the MAPKs that have been implicated in cell growth and differentiation.
• Extracellular signal-regulated kinase 8 (Erk8) is a large MAP kinase whose activity is controlled by serum and the c-Src non-receptor tyrosine kinase.
• ERK8 down-regulates transactivation of the glucocorticoid receptor through Hic-5 and can negatively regulate transcriptional co-activation of androgen receptor and GRalpha by Hic-5 in a kinase-independent manner, suggesting a broader role for ERK8 in the regulation of nuclear receptors beyond estrogen receptor alpha.
• Erk8 is a novel effector of RET/PTC3 and, therefore, RET biological functions.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMGCPPSPPPPTAVRTLSADTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSR*
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.